PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00062886001
Common NameGSBRNA2T00062886001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 171aa    MW: 18904.6 Da    PI: 9.4082
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00062886001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.57.1e-3955113260
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                          ++k+++cprC+s++tkfCy+nny+ +qPr+fCk+C+ryWt+GGalrnvPvG+grrk k 
  GSBRNA2T00062886001  55 PDKIIACPRCKSMDTKFCYFNNYNANQPRHFCKSCHRYWTAGGALRNVPVGAGRRKTKP 113
                          68999***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2854112IPR003851Zinc finger, Dof-type
PfamPF027012.2E-3257112IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.08159113IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106197IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1902455Biological Processnegative regulation of stem cell population maintenance
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MATQDLQGIK LFGKTIACNV NITDTHKIKN EDEKQPSDPT VRSSSLSDPT VEKRPDKIIA  60
CPRCKSMDTK FCYFNNYNAN QPRHFCKSCH RYWTAGGALR NVPVGAGRRK TKPLARVVVG  120
MLGDGNEAHH VELINGLLSH ELHSAAAARG GFRHDFPLKR LRCFSDGEPC *
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00062886001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013719282.11e-123PREDICTED: cyclic dof factor 4-like
RefseqXP_013635531.11e-123PREDICTED: cyclic dof factor 4-like
SwissprotO229679e-91CDF4_ARATH; Cyclic dof factor 4
TrEMBLA0A078JIK61e-127A0A078JIK6_BRANA; BnaC04g44370D protein
STRINGBra021895.1-P1e-120(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28092669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.16e-89Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]